ACVR1 Antikörper (N-Term)

Produktnummer ABIN635876

Produktdetails anti-ACVR1 Antikörper

Target: ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACVR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ACVR1 antibody was raised against the N terminal of ACVR1

Aufreinigung: Affinity purified

Immunogen: ACVR1 antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids TCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIIL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACVR1 Blocking Peptide, catalog no. 33R-8997, is also available for use as a blocking control in assays to test for specificity of this ACVR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACVR1

Target: ACVR1 (ACRV1) (Activin Receptor Type I (ACRV1))

Andere Bezeichnung: ACVR1 (ACRV1 Produkte)

Synonyme: ACTRI antikoerper, ACVR1A antikoerper, ACVRLK2 antikoerper, ALK2 antikoerper, FOP antikoerper, SKR1 antikoerper, TSRI antikoerper, ActR-IA antikoerper, ActR-I antikoerper, ActRIA antikoerper, Acvr antikoerper, Acvrlk2 antikoerper, Alk-2 antikoerper, Alk8 antikoerper, D330013D15Rik antikoerper, Tsk7L antikoerper, actri antikoerper, acvr1 antikoerper, acvr1-a antikoerper, acvr1-b antikoerper, acvr1a antikoerper, acvrlk2 antikoerper, alk-2 antikoerper, alk2 antikoerper, alk8 antikoerper, fop antikoerper, sax antikoerper, skr1 antikoerper, tsri antikoerper, xALK-2 antikoerper, activin A receptor type 1 antikoerper, activin A receptor, type 1 antikoerper, activin A receptor type 1 S homeolog antikoerper, ACVR1 antikoerper, Acvr1 antikoerper, acvr1.S antikoerper

Hintergrund: Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.

Molekulargewicht: 55 kDa (MW of target protein)