SLC24A6 Antikörper (Middle Region)
-
- Target Alle SLC24A6 Antikörper anzeigen
- SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC24A6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC24 A6 antibody was raised against the middle region of SLC24 6
- Aufreinigung
- Affinity purified
- Immunogen
- SLC24 A6 antibody was raised using the middle region of SLC24 6 corresponding to a region with amino acids SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE
- Top Product
- Discover our top product SLC24A6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC24A6 Blocking Peptide, catalog no. 33R-8526, is also available for use as a blocking control in assays to test for specificity of this SLC24A6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))
- Andere Bezeichnung
- SLC24A6 (SLC24A6 Produkte)
- Synonyme
- slc24a6 antikoerper, NCKX6 antikoerper, NCLX antikoerper, SLC24A6 antikoerper, AF261233 antikoerper, Slc24a6 antikoerper, solute carrier family 8 member B1 antikoerper, solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 antikoerper, solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 S homeolog antikoerper, SLC8B1 antikoerper, slc8b1 antikoerper, Slc8b1 antikoerper, slc8b1.S antikoerper
- Hintergrund
- SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis
-