PTPRR Antikörper (N-Term)
-
- Target Alle PTPRR Antikörper anzeigen
- PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTPRR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PTPRR antibody was raised against the N terminal of PTPRR
- Aufreinigung
- Affinity purified
- Immunogen
- PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids TATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKV
- Top Product
- Discover our top product PTPRR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PTPRR Blocking Peptide, catalog no. 33R-8987, is also available for use as a blocking control in assays to test for specificity of this PTPRR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))
- Andere Bezeichnung
- PTPRR (PTPRR Produkte)
- Synonyme
- EC-PTP antikoerper, PCPTP1 antikoerper, PTP-SL antikoerper, PTPBR7 antikoerper, PTPRQ antikoerper, Pcptp1 antikoerper, ec-ptp antikoerper, pcptp1 antikoerper, ptp-sl antikoerper, ptpbr7 antikoerper, PTPRR antikoerper, Gmcp1 antikoerper, RPTPRR antikoerper, mPTP213 antikoerper, protein tyrosine phosphatase, receptor type R antikoerper, protein tyrosine phosphatase, receptor type, R antikoerper, protein tyrosine phosphatase, receptor type R L homeolog antikoerper, protein tyrosine phosphatase, receptor type, r antikoerper, receptor-type tyrosine-protein phosphatase R antikoerper, PTPRR antikoerper, Ptprr antikoerper, ptprr.L antikoerper, ptprr antikoerper, LOC100715069 antikoerper
- Hintergrund
- PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family.
- Molekulargewicht
- 46 kDa (MW of target protein)
-