PTPRR Antikörper (N-Term)

Produktnummer ABIN635845

Produktdetails anti-PTPRR Antikörper

Target: PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTPRR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTPRR antibody was raised against the N terminal of PTPRR

Aufreinigung: Affinity purified

Immunogen: PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids TATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTPRR Blocking Peptide, catalog no. 33R-8987, is also available for use as a blocking control in assays to test for specificity of this PTPRR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTPRR

Target: PTPRR (Protein tyrosine Phosphatase, Receptor Type, R (PTPRR))

Andere Bezeichnung: PTPRR (PTPRR Produkte)

Synonyme: EC-PTP antikoerper, PCPTP1 antikoerper, PTP-SL antikoerper, PTPBR7 antikoerper, PTPRQ antikoerper, Pcptp1 antikoerper, ec-ptp antikoerper, pcptp1 antikoerper, ptp-sl antikoerper, ptpbr7 antikoerper, PTPRR antikoerper, Gmcp1 antikoerper, RPTPRR antikoerper, mPTP213 antikoerper, protein tyrosine phosphatase, receptor type R antikoerper, protein tyrosine phosphatase, receptor type, R antikoerper, protein tyrosine phosphatase, receptor type R L homeolog antikoerper, protein tyrosine phosphatase, receptor type, r antikoerper, receptor-type tyrosine-protein phosphatase R antikoerper, PTPRR antikoerper, Ptprr antikoerper, ptprr.L antikoerper, ptprr antikoerper, LOC100715069 antikoerper

Hintergrund: PTPRR is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domains, and thus represents a receptor-type PTP. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family.

Molekulargewicht: 46 kDa (MW of target protein)