SLC27A2 Antikörper

Produktnummer ABIN635835

Produktdetails anti-SLC27A2 Antikörper

Target: SLC27A2 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC27A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC27 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC27A2 Blocking Peptide, catalog no. 33R-5137, is also available for use as a blocking control in assays to test for specificity of this SLC27A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC27A2

Target: SLC27A2 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2))

Andere Bezeichnung: SLC27A2 (SLC27A2 Produkte)

Synonyme: vlcs antikoerper, fatp2 antikoerper, vlacs antikoerper, acsvl1 antikoerper, facvl1 antikoerper, im:7139614 antikoerper, slc27a2 antikoerper, wu:fb99g05 antikoerper, zgc:112376 antikoerper, ACSVL1 antikoerper, FACVL1 antikoerper, HsT17226 antikoerper, hFACVL1 antikoerper, FATP2 antikoerper, VLCS antikoerper, Vlac antikoerper, Vlacs antikoerper, VLACS antikoerper, solute carrier family 27 (fatty acid transporter), member 2 L homeolog antikoerper, solute carrier family 27 member 2 antikoerper, solute carrier family 27 (fatty acid transporter), member 2a antikoerper, solute carrier family 27 (fatty acid transporter), member 2 antikoerper, slc27a2.L antikoerper, SLC27A2 antikoerper, slc27a2a antikoerper, slc27a2 antikoerper, Slc27a2 antikoerper

Hintergrund: SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process, SARS-CoV-2 Protein Interaktom