CYP4F12 Antikörper (C-Term)

Produktnummer ABIN635833

Produktdetails anti-CYP4F12 Antikörper

Target: CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4F12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP4 F12 antibody was raised against the C terminal of CYP4 12

Aufreinigung: Affinity purified

Immunogen: CYP4 F12 antibody was raised using the C terminal of CYP4 12 corresponding to a region with amino acids TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4F12 Blocking Peptide, catalog no. 33R-9377, is also available for use as a blocking control in assays to test for specificity of this CYP4F12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4F12

Target: CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))

Andere Bezeichnung: CYP4F12 (CYP4F12 Produkte)

Synonyme: F22329_1 antikoerper, DKFZp469H0334 antikoerper, cytochrome P450 family 4 subfamily F member 12 antikoerper, cytochrome P450, family 4, subfamily F, polypeptide 12 antikoerper, cytochrome P450 4F12 antikoerper, CYP4F12 antikoerper, CpipJ_CPIJ016853 antikoerper, MCYG_08150 antikoerper

Hintergrund: CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid, however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process