TMED10 Antikörper
-
- Target Alle TMED10 Antikörper anzeigen
- TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMED10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF
- Top Product
- Discover our top product TMED10 Primärantikörper
-
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 101-200) antibody
TMED10 Reaktivität: Human, Maus WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (C-Term) antibodyVerified TMED10 Reaktivität: Human ELISA, IF, FACS Wirt: Ziege Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 156-185), (C-Term) antibodyTMED10 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB40979 unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 143-192) antibodyTMED10 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hamster, Xenopus laevis, Hund, Pferd, Affe, Zebrafisch (Danio rerio), Huhn, Meerschweinchen, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 100-200) antibodyTMED10 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hamster, Primate, Affe, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 50-150) antibodyTMED10 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Hamster, Primate, Xenopus laevis, Frosch, Affe WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (C-Term) antibodyTMED10 Reaktivität: Human, Maus, Ratte WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (Center) antibodyTMED10 Reaktivität: Human, Maus, Ratte WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 100-200) antibodyTMED10 Reaktivität: Human, Maus, Ratte, Kaninchen WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMED10 Blocking Peptide, catalog no. 33R-4515, is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))
- Andere Bezeichnung
- TMED10 (TMED10 Produkte)
- Synonyme
- tmp21 antikoerper, P24(DELTA) antikoerper, S31I125 antikoerper, S31III125 antikoerper, TMP21 antikoerper, Tmp-21-I antikoerper, p23 antikoerper, 1110014C03Rik antikoerper, Tmp21 antikoerper, p24delta1 antikoerper, fe06g04 antikoerper, wu:fb98e10 antikoerper, wu:fe06g04 antikoerper, zgc:85681 antikoerper, transmembrane p24 trafficking protein 10 L homeolog antikoerper, transmembrane p24 trafficking protein 10 antikoerper, tmed10.L antikoerper, TMED10 antikoerper, Tmed10 antikoerper, tmed10 antikoerper
- Hintergrund
- This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.
- Molekulargewicht
- 24 kDa (MW of target protein)
-
