CYP4X1 Antikörper (Middle Region)

Produktnummer ABIN635822

Produktdetails anti-CYP4X1 Antikörper

Target: CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4X1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP4 X1 antibody was raised against the middle region of CYP4 1

Aufreinigung: Affinity purified

Immunogen: CYP4 X1 antibody was raised using the middle region of CYP4 1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4X1 Blocking Peptide, catalog no. 33R-4850, is also available for use as a blocking control in assays to test for specificity of this CYP4X1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4X1

Target: CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))

Andere Bezeichnung: CYP4X1 (CYP4X1 Produkte)

Synonyme: CYPIVX1 antikoerper, A230025G20 antikoerper, CYP_a antikoerper, Cyp4a28-ps antikoerper, cytochrome P450 family 4 subfamily X member 1 antikoerper, cytochrome P450, family 4, subfamily x, polypeptide 1 antikoerper, CYP4X1 antikoerper, Cyp4x1 antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha