PILRB Antikörper (Middle Region)
-
- Target Alle PILRB Antikörper anzeigen
- PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PILRB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PILRB antibody was raised against the middle region of PILRB
- Aufreinigung
- Affinity purified
- Immunogen
- PILRB antibody was raised using the middle region of PILRB corresponding to a region with amino acids KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA
- Top Product
- Discover our top product PILRB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PILRB Blocking Peptide, catalog no. 33R-4545, is also available for use as a blocking control in assays to test for specificity of this PILRB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))
- Andere Bezeichnung
- PILRB (PILRB Produkte)
- Synonyme
- FDFACT1 antikoerper, FDFACT2 antikoerper, FDFACT antikoerper, Fdact antikoerper, Pilrb antikoerper, paired immunoglobin-like type 2 receptor beta antikoerper, paired immunoglobin-like type 2 receptor beta 1 antikoerper, PILRB antikoerper, Pilrb1 antikoerper, Pilrb antikoerper
- Hintergrund
- Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface.
- Molekulargewicht
- 23 kDa (MW of target protein)
-