PILRB Antikörper (Middle Region)

Produktnummer ABIN635800

Produktdetails anti-PILRB Antikörper

Target: PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PILRB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PILRB antibody was raised against the middle region of PILRB

Aufreinigung: Affinity purified

Immunogen: PILRB antibody was raised using the middle region of PILRB corresponding to a region with amino acids KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PILRB Blocking Peptide, catalog no. 33R-4545, is also available for use as a blocking control in assays to test for specificity of this PILRB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PILRB

Target: PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))

Andere Bezeichnung: PILRB (PILRB Produkte)

Synonyme: FDFACT1 antikoerper, FDFACT2 antikoerper, FDFACT antikoerper, Fdact antikoerper, Pilrb antikoerper, paired immunoglobin-like type 2 receptor beta antikoerper, paired immunoglobin-like type 2 receptor beta 1 antikoerper, PILRB antikoerper, Pilrb1 antikoerper, Pilrb antikoerper

Hintergrund: Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface.

Molekulargewicht: 23 kDa (MW of target protein)