MMP20 Antikörper (Middle Region)

Produktnummer ABIN635771

Produktdetails anti-MMP20 Antikörper

Target: MMP20 (Matrix Metalloproteinase 20 (MMP20))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MMP20 antibody was raised against the middle region of MMP20

Aufreinigung: Affinity purified

Immunogen: MMP20 antibody was raised using the middle region of MMP20 corresponding to a region with amino acids AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP20 Blocking Peptide, catalog no. 33R-1063, is also available for use as a blocking control in assays to test for specificity of this MMP20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP20

Target: MMP20 (Matrix Metalloproteinase 20 (MMP20))

Andere Bezeichnung: MMP20 (MMP20 Produkte)

Synonyme: AI2A2 antikoerper, MMP-20 antikoerper, MMP25 antikoerper, MMP20 antikoerper, mmp20 antikoerper, matrix metallopeptidase 20 antikoerper, matrix metallopeptidase 20 L homeolog antikoerper, matrix metallopeptidase 20 (enamelysin) antikoerper, MMP20 antikoerper, mmp20.L antikoerper, Mmp20 antikoerper

Hintergrund: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.

Molekulargewicht: 43 kDa (MW of target protein)