FZD2 Antikörper

Produktnummer ABIN635757

Produktdetails anti-FZD2 Antikörper

Target: FZD2 (Frizzled Family Receptor 2 (FZD2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FZD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FZD2 Blocking Peptide, catalog no. 33R-6374, is also available for use as a blocking control in assays to test for specificity of this FZD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FZD2

Target: FZD2 (Frizzled Family Receptor 2 (FZD2))

Andere Bezeichnung: FZD2 (FZD2 Produkte)

Synonyme: BG01711 antikoerper, CG9739 antikoerper, D-Fz2 antikoerper, D-fz2 antikoerper, DFZ2 antikoerper, DFz-2 antikoerper, DFz2 antikoerper, Dfrz2 antikoerper, Dfz2 antikoerper, Dfz[[2]] antikoerper, Dm Fz2 antikoerper, Dmel\\CG9739 antikoerper, FZ2 antikoerper, Fz2 antikoerper, dFz2 antikoerper, dfz(2) antikoerper, dfz2 antikoerper, dfz2r antikoerper, frz2 antikoerper, fz-2 antikoerper, fz8 antikoerper, zfz2 antikoerper, zg08 antikoerper, cb383 antikoerper, wu:fb70g09 antikoerper, FZD2 antikoerper, fzE2 antikoerper, hFz2 antikoerper, Fz-10 antikoerper, Fzd10 antikoerper, cFz-2 antikoerper, frizzled2 antikoerper, fz2 antikoerper, xfz2 antikoerper, AL033370 antikoerper, AW456835 antikoerper, Fz10 antikoerper, Mfz10 antikoerper, Mfz10a antikoerper, frizzled 2 antikoerper, frizzled class receptor 2 antikoerper, frizzled class receptor 2 S homeolog antikoerper, fz2 antikoerper, fzd2 antikoerper, FZD2 antikoerper, Fzd2 antikoerper, fzd2.S antikoerper

Hintergrund: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: WNT Signalweg