B3GALT1 Antikörper (C-Term)

Produktnummer ABIN635750

Produktdetails anti-B3GALT1 Antikörper

Target: B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GALT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: B3 GALT1 antibody was raised against the C terminal of B3 ALT1

Aufreinigung: Affinity purified

Immunogen: B3 GALT1 antibody was raised using the C terminal of B3 ALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B3GALT1 Blocking Peptide, catalog no. 33R-10158, is also available for use as a blocking control in assays to test for specificity of this B3GALT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B3GALT1

Target: B3GALT1 (UDP-Gal:betaGlcNAc beta 1,3-Galactosyltransferase, Polypeptide 1 (B3GALT1))

Andere Bezeichnung: B3GALT1 (B3GALT1 Produkte)

Synonyme: beta3Gal-T1 antikoerper, Beta3GalT1 antikoerper, beta-1,3-galactosyltransferase 1 antikoerper, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 antikoerper, Beta-1,3-galactosyltransferase 1 antikoerper, B3GALT1 antikoerper, B3galt1 antikoerper

Hintergrund: B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon.

Molekulargewicht: 38 kDa (MW of target protein)