LRFN3 Antikörper (C-Term)
-
- Target Alle LRFN3 Antikörper anzeigen
- LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRFN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRFN3 antibody was raised against the C terminal of LRFN3
- Aufreinigung
- Affinity purified
- Immunogen
- LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS
- Top Product
- Discover our top product LRFN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRFN3 Blocking Peptide, catalog no. 33R-9926, is also available for use as a blocking control in assays to test for specificity of this LRFN3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))
- Andere Bezeichnung
- LRFN3 (LRFN3 Produkte)
- Synonyme
- FIGLER1 antikoerper, SALM4 antikoerper, A530045B06Rik antikoerper, Salm4 antikoerper, LRFN3 antikoerper, leucine rich repeat and fibronectin type III domain containing 3 antikoerper, LRFN3 antikoerper, Lrfn3 antikoerper
- Hintergrund
- LRFN3 belongs to the LRFN family. Its exact function remains unknown.
- Molekulargewicht
- 66 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-