SEMA6A Antikörper (Middle Region)

Produktnummer ABIN635707

Produktdetails anti-SEMA6A Antikörper

Target: SEMA6A (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6A (SEMA6A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEMA6A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SEMA6 A antibody was raised against the middle region of SEMA6

Aufreinigung: Affinity purified

Immunogen: SEMA6 A antibody was raised using the middle region of SEMA6 corresponding to a region with amino acids ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEMA6A Blocking Peptide, catalog no. 33R-2716, is also available for use as a blocking control in assays to test for specificity of this SEMA6A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEMA6A

Target: SEMA6A (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6A (SEMA6A))

Andere Bezeichnung: SEMA6A (SEMA6A Produkte)

Synonyme: fj46c12 antikoerper, wu:fj46c12 antikoerper, zgc:66106 antikoerper, SEMA6A antikoerper, HT018 antikoerper, SEMA antikoerper, SEMA6A1 antikoerper, SEMAQ antikoerper, VIA antikoerper, 9330158E07 antikoerper, A730020P05Rik antikoerper, AI851735 antikoerper, Sema6A-1 antikoerper, Semaq antikoerper, VIa antikoerper, b2b997Clo antikoerper, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A antikoerper, semaphorin 6A antikoerper, sema6a antikoerper, SEMA6A antikoerper, Sema6a antikoerper

Hintergrund: SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation.

Molekulargewicht: 114 kDa (MW of target protein)