DLL3 Antikörper

Produktnummer ABIN635694

Produktdetails anti-DLL3 Antikörper

Target: DLL3 (delta Like Protein 3 (DLL3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLL3 Blocking Peptide, catalog no. 33R-6609, is also available for use as a blocking control in assays to test for specificity of this DLL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLL3

Target: DLL3 (delta Like Protein 3 (DLL3))

Andere Bezeichnung: DLL3 (DLL3 Produkte)

Synonyme: SCDO1 antikoerper, pu antikoerper, pudgy antikoerper, delta like canonical Notch ligand 3 antikoerper, delta-like 3 (Drosophila) antikoerper, DLL3 antikoerper, Dll3 antikoerper

Hintergrund: DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Notch Signalweg