RPN1 Antikörper (Middle Region)
-
- Target Alle RPN1 Antikörper anzeigen
- RPN1 (Ribophorin 1 (RPN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ribophorin I antibody was raised against the middle region of RPN1
- Aufreinigung
- Affinity purified
- Immunogen
- Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK
- Top Product
- Discover our top product RPN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ribophorin I Blocking Peptide, catalog no. 33R-1015, is also available for use as a blocking control in assays to test for specificity of this Ribophorin I antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPN1 (Ribophorin 1 (RPN1))
- Andere Bezeichnung
- Ribophorin I (RPN1 Produkte)
- Synonyme
- OST1 antikoerper, RBPH1 antikoerper, AU018702 antikoerper, D6Wsu137e antikoerper, Rpn-1 antikoerper, RIBI antikoerper, wu:fa12h07 antikoerper, wu:fc68b07 antikoerper, wu:fc88a12 antikoerper, ost1 antikoerper, xrpn1 antikoerper, ribophorin I antikoerper, ribophorin I L homeolog antikoerper, PVX_119685 antikoerper, NAEGRDRAFT_78171 antikoerper, RPN1 antikoerper, Rpn1 antikoerper, rpn1 antikoerper, rpn1.L antikoerper
- Hintergrund
- This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.
- Molekulargewicht
- 66 kDa (MW of target protein)
-