ATP5G2 Antikörper
-
- Target Alle ATP5G2 Antikörper anzeigen
- ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP5G2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ATP5 G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA
- Top Product
- Discover our top product ATP5G2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP5G2 Blocking Peptide, catalog no. 33R-8767, is also available for use as a blocking control in assays to test for specificity of this ATP5G2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))
- Andere Bezeichnung
- ATP5G2 (ATP5G2 Produkte)
- Synonyme
- GB16842 antikoerper, 1810041M08Rik antikoerper, ATP5A antikoerper, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) antikoerper, ATP synthase, H+ transporting, mitochondrial Fo complex subunit C2 (subunit 9) antikoerper, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) antikoerper, ATP5G2 antikoerper, Atp5g2 antikoerper
- Hintergrund
- ATP5G2 is a subunit of mitochondrial ATP synthase.
- Molekulargewicht
- 8 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-