DENND1B Antikörper (N-Term)

Produktnummer ABIN635648

Produktdetails anti-DENND1B Antikörper

Target: DENND1B (DENN/MADD Domain Containing 1B (DENND1B))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DENND1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DENND1 B antibody was raised against the N terminal of DENND1

Aufreinigung: Affinity purified

Immunogen: DENND1 B antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DENND1B Blocking Peptide, catalog no. 33R-10151, is also available for use as a blocking control in assays to test for specificity of this DENND1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DENND1B

Target: DENND1B (DENN/MADD Domain Containing 1B (DENND1B))

Andere Bezeichnung: DENND1B (DENND1B Produkte)

Synonyme: C1ORF18 antikoerper, C1orf218 antikoerper, FAM31B antikoerper, 4632404N19Rik antikoerper, 4930467M19Rik antikoerper, 6820401H01Rik antikoerper, F730008N07Rik antikoerper, Fam31b antikoerper, si:ch211-195i21.1 antikoerper, DENN domain containing 1B antikoerper, DENN/MADD domain containing 1B antikoerper, DENND1B antikoerper, dennd1b antikoerper, Dennd1b antikoerper

Hintergrund: DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.

Molekulargewicht: 45 kDa (MW of target protein)