SERPINB13 Antikörper

Produktnummer ABIN635641

Produktdetails anti-SERPINB13 Antikörper

Target: SERPINB13 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 13 (SERPINB13))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPINB13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SERPINB13 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINB13 Blocking Peptide, catalog no. 33R-8019, is also available for use as a blocking control in assays to test for specificity of this SERPINB13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPINB13

Target: SERPINB13 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 13 (SERPINB13))

Andere Bezeichnung: SERPINB13 (SERPINB13 Produkte)

Synonyme: HSHUR7SEQ antikoerper, HUR7 antikoerper, PI13 antikoerper, headpin antikoerper, 5430417G24 antikoerper, HURPIN antikoerper, SERPINB13 antikoerper, SERPINB5 antikoerper, serpin family B member 13 antikoerper, serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 13 antikoerper, serpin family B member 12 antikoerper, SERPINB13 antikoerper, Serpinb13 antikoerper, SERPINB12 antikoerper

Hintergrund: SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

Molekulargewicht: 44 kDa (MW of target protein)