SLC14A1 Antikörper (C-Term)

Produktnummer ABIN635632

Produktdetails anti-SLC14A1 Antikörper

Target: SLC14A1 (Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC14A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SLC14 A1 antibody was raised against the C terminal of SLC14 1

Aufreinigung: Affinity purified

Immunogen: SLC14 A1 antibody was raised using the C terminal of SLC14 1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC14A1 Blocking Peptide, catalog no. 33R-5455, is also available for use as a blocking control in assays to test for specificity of this SLC14A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC14A1

Target: SLC14A1 (Solute Carrier Family 14 (Urea Transporter), Member 1 (Kidd Blood Group) (SLC14A1))

Andere Bezeichnung: SLC14A1 (SLC14A1 Produkte)

Synonyme: HUT11 antikoerper, HsT1341 antikoerper, JK antikoerper, RACH1 antikoerper, RACH2 antikoerper, UT-B1 antikoerper, UT1 antikoerper, UTE antikoerper, 2610507K20Rik antikoerper, 3021401A05Rik antikoerper, UT-B antikoerper, Utb1 antikoerper, UT3 antikoerper, UTB1 antikoerper, UrT2 antikoerper, UT-1 antikoerper, solute carrier family 14 member 1 (Kidd blood group) antikoerper, solute carrier family 14 (urea transporter), member 1 antikoerper, solute carrier family 14 member 1 antikoerper, SLC14A1 antikoerper, Slc14a1 antikoerper

Hintergrund: SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

Molekulargewicht: 42 kDa (MW of target protein)