SLC22A8 Antikörper
-
- Target Alle SLC22A8 Antikörper anzeigen
- SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC22 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
- Top Product
- Discover our top product SLC22A8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A8 Blocking Peptide, catalog no. 33R-7064, is also available for use as a blocking control in assays to test for specificity of this SLC22A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))
- Andere Bezeichnung
- SLC22A8 (SLC22A8 Produkte)
- Synonyme
- OAT3 antikoerper, Oat3 antikoerper, Roct antikoerper, OCT3 antikoerper, solute carrier family 22 member 8 antikoerper, solute carrier family 22 (organic anion transporter), member 8 antikoerper, SLC22A8 antikoerper, Slc22a8 antikoerper
- Hintergrund
- SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
- Molekulargewicht
- 60 kDa (MW of target protein)
-