PILRA Antikörper (N-Term)

Produktnummer ABIN635597

Produktdetails anti-PILRA Antikörper

Target: PILRA (Paired Immunoglobin-Like Type 2 Receptor alpha (PILRA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PILRA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PILRA antibody was raised against the N terminal of PILRA

Aufreinigung: Affinity purified

Immunogen: PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PILRA Blocking Peptide, catalog no. 33R-4090, is also available for use as a blocking control in assays to test for specificity of this PILRA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PILRA

Target: PILRA (Paired Immunoglobin-Like Type 2 Receptor alpha (PILRA))

Andere Bezeichnung: PILRA (PILRA Produkte)

Synonyme: PILRA antikoerper, FDF03 antikoerper, AV021745 antikoerper, RGD1562847 antikoerper, paired immunoglobin like type 2 receptor alpha antikoerper, paired immunoglobulin-like type 2 receptor alpha antikoerper, paired immunoglobin-like type 2 receptor alpha antikoerper, PILRA antikoerper, LOC489841 antikoerper, Pilra antikoerper

Hintergrund: Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role.

Molekulargewicht: 18 kDa (MW of target protein)