TMEM74 Antikörper (Middle Region)
-
- Target Alle TMEM74 Antikörper anzeigen
- TMEM74 (Transmembrane Protein 74 (TMEM74))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM74 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM74 antibody was raised against the middle region of TMEM74
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM74 antibody was raised using the middle region of TMEM74 corresponding to a region with amino acids ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR
- Top Product
- Discover our top product TMEM74 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM74 Blocking Peptide, catalog no. 33R-2701, is also available for use as a blocking control in assays to test for specificity of this TMEM74 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM74 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM74 (Transmembrane Protein 74 (TMEM74))
- Andere Bezeichnung
- TMEM74 (TMEM74 Produkte)
- Synonyme
- NET36 antikoerper, AA549547 antikoerper, B230382K22Rik antikoerper, RGD1566279 antikoerper, transmembrane protein 74 antikoerper, Transmembrane protein 74 antikoerper, TMEM74 antikoerper, tmm74 antikoerper, Tmem74 antikoerper
- Hintergrund
- TMEM74 plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.
- Molekulargewicht
- 33 kDa (MW of target protein)
-