MAN1A2 Antikörper (Middle Region)

Produktnummer ABIN635557

Produktdetails anti-MAN1A2 Antikörper

Target: MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAN1A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAN1 A2 antibody was raised against the middle region of MAN1 2

Aufreinigung: Affinity purified

Immunogen: MAN1 A2 antibody was raised using the middle region of MAN1 2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAN1A2 Blocking Peptide, catalog no. 33R-2844, is also available for use as a blocking control in assays to test for specificity of this MAN1A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAN0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAN1A2

Target: MAN1A2 (Mannosidase, Alpha, Class 1A, Member 2 (MAN1A2))

Andere Bezeichnung: MAN1A2 (MAN1A2 Produkte)

Synonyme: man1b antikoerper, MAN1B antikoerper, AI428775 antikoerper, AI528764 antikoerper, AI854422 antikoerper, Man1b antikoerper, PCR2 antikoerper, mannosidase, alpha, class 1A, member 2 L homeolog antikoerper, mannosidase alpha class 1A member 2 antikoerper, mannosidase, alpha, class 1A, member 2 antikoerper, man1a2.L antikoerper, MAN1A2 antikoerper, Man1a2 antikoerper

Hintergrund: Alpha-mannosidases function at different stages of N-glycan maturation in mammalian cells.

Molekulargewicht: 73 kDa (MW of target protein)