VTI1A Antikörper

Produktnummer ABIN635544

Produktdetails anti-VTI1A Antikörper

Target: VTI1A (Vesicle Transport through Interaction with t-SNAREs 1A (VTI1A))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VTI1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VTI1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VTI1A Blocking Peptide, catalog no. 33R-8790, is also available for use as a blocking control in assays to test for specificity of this VTI1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTI0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VTI1A

Target: VTI1A (Vesicle Transport through Interaction with t-SNAREs 1A (VTI1A))

Andere Bezeichnung: VTI1A (VTI1A Produkte)

Synonyme: zgc:109895 antikoerper, mvti1 antikoerper, vti1-rp2 antikoerper, DDBDRAFT_0219803 antikoerper, DDBDRAFT_0231536 antikoerper, DDB_0219803 antikoerper, DDB_0231536 antikoerper, MMDS3 antikoerper, MVti1 antikoerper, VTI1RP2 antikoerper, Vti1-rp2 antikoerper, 1110014F16Rik antikoerper, 1110018K19Rik antikoerper, 4921537J05Rik antikoerper, MVti1a antikoerper, Vti1 antikoerper, vesicle transport through interaction with t-SNAREs 1A L homeolog antikoerper, vesicle transport through interaction with t-SNAREs 1A antikoerper, v-SNARE family protein antikoerper, vti1a.L antikoerper, vti1a antikoerper, VTI1A antikoerper, vti1A antikoerper, Vti1a antikoerper

Hintergrund: VTI1A is a V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. VTI1A may be concerned with increased secretion of cytokines associated with cellular senescence.

Molekulargewicht: 25 kDa (MW of target protein)