MMP23B Antikörper (Middle Region)

Produktnummer ABIN635532

Produktdetails anti-MMP23B Antikörper

Target: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMP23B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MMP23 B antibody was raised against the middle region of MMP23

Aufreinigung: Affinity purified

Immunogen: MMP23 B antibody was raised using the middle region of MMP23 corresponding to a region with amino acids QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MMP23B Blocking Peptide, catalog no. 33R-7605, is also available for use as a blocking control in assays to test for specificity of this MMP23B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMP23B

Target: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Andere Bezeichnung: MMP23B (MMP23B Produkte)

Synonyme: MIFR antikoerper, MIFR-1 antikoerper, MMP22 antikoerper, MMP23A antikoerper, MMP23 antikoerper, mmp23al antikoerper, mmp23b antikoerper, zgc:110623 antikoerper, MMP23B antikoerper, matrix metallopeptidase 23B antikoerper, matrix metallopeptidase 23bb antikoerper, MMP23B antikoerper, mmp23bb antikoerper, Mmp23b antikoerper

Hintergrund: MMP23B encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.

Molekulargewicht: 36 kDa (MW of target protein)