ATP4b Antikörper (Middle Region)
-
- Target Alle ATP4b Antikörper anzeigen
- ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP4b Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATP4 B antibody was raised against the middle region of ATP4
- Aufreinigung
- Affinity purified
- Immunogen
- ATP4 B antibody was raised using the middle region of ATP4 corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK
- Top Product
- Discover our top product ATP4b Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP4B Blocking Peptide, catalog no. 33R-7776, is also available for use as a blocking control in assays to test for specificity of this ATP4B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))
- Andere Bezeichnung
- ATP4B (ATP4b Produkte)
- Synonyme
- AV080843 antikoerper, S76401S1 antikoerper, ATP6B antikoerper, ATPase, H+/K+ exchanging, beta polypeptide antikoerper, ATPase H+/K+ transporting beta subunit antikoerper, ATPase, H+/K+ exchanging, beta polypeptide S homeolog antikoerper, ATPase H+/K+ transporting alpha subunit antikoerper, Atp4b antikoerper, atp4b.S antikoerper, ATP4B antikoerper, ATP4A antikoerper
- Hintergrund
- ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Proton Transport
-