ELFN2 Antikörper (N-Term)
-
- Target Alle ELFN2 Antikörper anzeigen
- ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ELFN2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ELFN2 antibody was raised against the N terminal of ELFN2
- Aufreinigung
- Affinity purified
- Immunogen
- ELFN2 antibody was raised using the N terminal of ELFN2 corresponding to a region with amino acids PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH
- Top Product
- Discover our top product ELFN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ELFN2 Blocking Peptide, catalog no. 33R-7422, is also available for use as a blocking control in assays to test for specificity of this ELFN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELFN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELFN2 (Extracellular Leucine-Rich Repeat and Fibronectin Type III Domain Containing 2 (ELFN2))
- Andere Bezeichnung
- ELFN2 (ELFN2 Produkte)
- Synonyme
- LRRC62 antikoerper, PPP1R29 antikoerper, dJ63G5.3 antikoerper, 6330514E13 antikoerper, AW048948 antikoerper, BC094219 antikoerper, Lrrc62 antikoerper, Ppp1r29 antikoerper, Elfn2-ps1 antikoerper, RGD1559693 antikoerper, extracellular leucine rich repeat and fibronectin type III domain containing 2 antikoerper, leucine rich repeat and fibronectin type III, extracellular 2 antikoerper, extracellular leucine-rich repeat and fibronectin type III domain containing 2 antikoerper, ELFN2 antikoerper, Elfn2 antikoerper
- Hintergrund
- ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.
- Molekulargewicht
- 90 kDa (MW of target protein)
-