FAM134B Antikörper (Family with Sequence Similarity 134, Member B) (Middle Region)

Details for Product anti-FAM134B Antibody No. ABIN635407
Antigen
Epitop
Middle Region
5
4
3
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
32
21
21
5
4
4
4
4
2
1
1
1
Wirt
Kaninchen
29
3
Klonalität
Polyklonal
Konjugat
Dieser FAM134B Antikörper ist unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
16
13
5
5
5
Optionen
Immunogen FAM134 B antibody was raised using the middle region of FAM134 corresponding to a region with amino acids DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV
Spezifität FAM134 B antibody was raised against the middle region of FAM134
Reinigung Affinity purified
Antigen
Andere Bezeichnung FAM134B (FAM134B Antibody Abstract)
Hintergrund FAM134B is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Defects in this gene are a cause of hereditary sensory and autonomic neuropathy type II (HSAN II).
Molekulargewicht 55 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FAM134B Blocking Peptide, catalog no. 33R-1928, is also available for use as a blocking control in assays to test for specificity of this FAM134B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Family with Sequence Similarity 134, Member B (FAM134B) (Middle Region) antibody (ABIN635407) FAM134B antibody used at 1 ug/ml to detect target protein.