GLT8D1 Antikörper (Middle Region)

Produktnummer ABIN635397

Produktdetails anti-GLT8D1 Antikörper

Target: GLT8D1 (Glycosyltransferase 8 Domain Containing 1 (GLT8D1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLT8D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLT8 D1 antibody was raised against the middle region of GLT8 1

Aufreinigung: Affinity purified

Immunogen: GLT8 D1 antibody was raised using the middle region of GLT8 1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLT8D1 Blocking Peptide, catalog no. 33R-5151, is also available for use as a blocking control in assays to test for specificity of this GLT8D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLT8D1

Target: GLT8D1 (Glycosyltransferase 8 Domain Containing 1 (GLT8D1))

Andere Bezeichnung: GLT8D1 (GLT8D1 Produkte)

Synonyme: MSTP139 antikoerper, 2410004H05Rik antikoerper, 5430414N14Rik antikoerper, AI450005 antikoerper, Da2-24 antikoerper, wu:fc60b12 antikoerper, zgc:103525 antikoerper, glycosyltransferase 8 domain containing 1 antikoerper, glycosyltransferase 8 domain containing 1 L homeolog antikoerper, GLT8D1 antikoerper, Glt8d1 antikoerper, glt8d1 antikoerper, glt8d1.L antikoerper

Hintergrund: GLT8D1 is a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described.

Molekulargewicht: 42 kDa (MW of target protein)