TTYH1 Antikörper

Produktnummer ABIN635388

Produktdetails anti-TTYH1 Antikörper

Target: TTYH1 (Tweety Homolog 1 (TTYH1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TTYH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TTYH1 Blocking Peptide, catalog no. 33R-3168, is also available for use as a blocking control in assays to test for specificity of this TTYH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTYH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TTYH1

Target: TTYH1 (Tweety Homolog 1 (TTYH1))

Andere Bezeichnung: TTYH1 (TTYH1 Produkte)

Synonyme: 4930459B04Rik antikoerper, 6330408P11Rik antikoerper, tty antikoerper, TTYH1 antikoerper, ttyh1-A antikoerper, tweety family member 1 antikoerper, tweety family member 1 L homeolog antikoerper, Protein tweety homolog 1 antikoerper, Ttyh1 antikoerper, TTYH1 antikoerper, ttyh1.L antikoerper, ttyh-1 antikoerper

Hintergrund: TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Molekulargewicht: 49 kDa (MW of target protein)