SLC27A6 Antikörper

Produktnummer ABIN635364

Produktdetails anti-SLC27A6 Antikörper

Target: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC27A6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC27 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC27A6 Blocking Peptide, catalog no. 33R-4665, is also available for use as a blocking control in assays to test for specificity of this SLC27A6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC27A6

Target: SLC27A6 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 6 (SLC27A6))

Andere Bezeichnung: SLC27A6 (SLC27A6 Produkte)

Synonyme: zgc:153783 antikoerper, ACSVL2 antikoerper, FACVL2 antikoerper, FATP6 antikoerper, VLCS-H1 antikoerper, 4732438L20Rik antikoerper, solute carrier family 27 member 6 antikoerper, solute carrier family 27 (fatty acid transporter), member 6 antikoerper, solute carrier family 27 member 6 L homeolog antikoerper, SLC27A6 antikoerper, slc27a6 antikoerper, slc27a6.L antikoerper, Slc27a6 antikoerper

Hintergrund: SLC27A6 is a member of the fatty acid transport protein family (FATP). FATPs are involved in the uptake of long-chain fatty acids and have unique expression patterns. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 70 kDa (MW of target protein)