SLC5A9 Antikörper
-
- Target Alle SLC5A9 Antikörper anzeigen
- SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC5A9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC5 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA
- Top Product
- Discover our top product SLC5A9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC5A9 Blocking Peptide, catalog no. 33R-6447, is also available for use as a blocking control in assays to test for specificity of this SLC5A9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))
- Andere Bezeichnung
- SLC5A9 (SLC5A9 Produkte)
- Synonyme
- SLC5A9 antikoerper, SGLT4 antikoerper, AI159731 antikoerper, solute carrier family 5 member 9 antikoerper, solute carrier family 5 (sodium/sugar cotransporter), member 9 antikoerper, solute carrier family 5 (sodium/glucose cotransporter), member 9 antikoerper, Slc5a9 antikoerper, SLC5A9 antikoerper, slc5a9 antikoerper
- Hintergrund
- SLC5A9 is involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.
- Molekulargewicht
- 76 kDa (MW of target protein)
-