OR2AT4 Antikörper (N-Term)

Produktnummer ABIN635349

Produktdetails anti-OR2AT4 Antikörper

Target: OR2AT4 (Olfactory Receptor, Family 2, Subfamily AT, Member 4 (OR2AT4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OR2AT4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OR2 AT4 antibody was raised against the N terminal of OR2 T4

Aufreinigung: Affinity purified

Immunogen: OR2 AT4 antibody was raised using the N terminal of OR2 T4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OR2AT4 Blocking Peptide, catalog no. 33R-5822, is also available for use as a blocking control in assays to test for specificity of this OR2AT4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 T4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OR2AT4

Target: OR2AT4 (Olfactory Receptor, Family 2, Subfamily AT, Member 4 (OR2AT4))

Andere Bezeichnung: OR2AT4 (OR2AT4 Produkte)

Synonyme: OR11-265 antikoerper, olfactory receptor family 2 subfamily AT member 4 antikoerper, OR2AT4 antikoerper

Hintergrund: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Molekulargewicht: 35 kDa (MW of target protein)