OR6C68 Antikörper (N-Term)

Produktnummer ABIN635347

Produktdetails anti-OR6C68 Antikörper

Target: OR6C68 (Olfactory Receptor, Family 6, Subfamily C, Member 68 (OR6C68))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OR6C68 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OR6 C68 antibody was raised against the N terminal of OR6 68

Aufreinigung: Affinity purified

Immunogen: OR6 C68 antibody was raised using the N terminal of OR6 68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OR6C68 Blocking Peptide, catalog no. 33R-6330, is also available for use as a blocking control in assays to test for specificity of this OR6C68 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 68 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OR6C68

Target: OR6C68 (Olfactory Receptor, Family 6, Subfamily C, Member 68 (OR6C68))

Andere Bezeichnung: OR6C68 (OR6C68 Produkte)

Synonyme: olfactory receptor family 6 subfamily C member 68 antikoerper, OR6C68 antikoerper

Hintergrund: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Molekulargewicht: 36 kDa (MW of target protein)