SLC7A1 Antikörper
-
- Target Alle SLC7A1 Antikörper anzeigen
- SLC7A1 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC7A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC7 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF
- Top Product
- Discover our top product SLC7A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC7A1 Blocking Peptide, catalog no. 33R-4972, is also available for use as a blocking control in assays to test for specificity of this SLC7A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A1 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1))
- Andere Bezeichnung
- SLC7A1 (SLC7A1 Produkte)
- Synonyme
- ATRC1 antikoerper, CAT-1 antikoerper, ERR antikoerper, HCAT1 antikoerper, REC1L antikoerper, CAT1 antikoerper, CATIONIC AMINO ACID TRANSPORTER 1 antikoerper, F7J7.60 antikoerper, F7J7_60 antikoerper, amino acid transporter 1 antikoerper, 4831426K01Rik antikoerper, AI447493 antikoerper, Atrc-1 antikoerper, Atrc1 antikoerper, Cat1 antikoerper, Rec-1 antikoerper, Rev-1 antikoerper, mCAT-1 antikoerper, Cat-1 antikoerper, si:ch211-69k21.2 antikoerper, DKFZp459K194 antikoerper, solute carrier family 7 member 1 antikoerper, amino acid transporter 1 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 antikoerper, cationic amino acid transporter Cat1 antikoerper, SLC7A1 antikoerper, AAT1 antikoerper, Slc7a1 antikoerper, slc7a1 antikoerper, cat1 antikoerper
- Hintergrund
- SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-