FAM105A Antikörper (Family with Sequence Similarity 105, Member A) (N-Term)

Details for Product anti-FAM105A Antibody No. ABIN635319
Antigen
Epitop
N-Term
8
4
3
1
1
1
1
Reaktivität
Human
27
6
6
4
4
4
4
3
2
2
1
Wirt
Kaninchen
27
Klonalität
Polyklonal
Konjugat
Dieser FAM105A Antikörper ist unkonjugiert
3
2
2
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
19
14
9
3
1
Optionen
Immunogen FAM105 A antibody was raised using the N terminal of FAM105 corresponding to a region with amino acids HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE
Spezifität FAM105 A antibody was raised against the N terminal of FAM105
Reinigung Affinity purified
Antigen
Andere Bezeichnung FAM105A
Hintergrund FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown.
Molekulargewicht 42 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FAM105A Blocking Peptide, catalog no. 33R-3765, is also available for use as a blocking control in assays to test for specificity of this FAM105A antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM100 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Family with Sequence Similarity 105, Member A (FAM105A) (N-Term) antibody (ABIN635319) FAM105A antibody used at 1 ug/ml to detect target protein.