Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 8 (SLC2A8) Antikörper

Details zu Produkt Nr. ABIN635294
Antigen
Reaktivität
Human
44
36
31
2
Wirt
Kaninchen
41
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
16
13
13
7
5
2
Optionen
Immunogen GLUT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
Reinigung Affinity purified
Antigen
Andere Bezeichnung GLUT8 (SLC2A8 Antibody Abstract)
Hintergrund SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.
Molekulargewicht 51 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GLUT8 Blocking Peptide, catalog no. 33R-9684, is also available for use as a blocking control in assays to test for specificity of this GLUT8 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 8 (SLC2A8) antibody (ABIN635294) GLUT8 antibody used at 1 ug/ml to detect target protein.