ABCC11 Antikörper
-
- Target Alle ABCC11 Antikörper anzeigen
- ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCC11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
- Top Product
- Discover our top product ABCC11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCC11 Blocking Peptide, catalog no. 33R-6880, is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC11 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11))
- Andere Bezeichnung
- ABCC11 (ABCC11 Produkte)
- Synonyme
- EWWD antikoerper, MRP8 antikoerper, WW antikoerper, ATP binding cassette subfamily C member 11 antikoerper, ABCC11 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
- Molekulargewicht
- 154 kDa (MW of target protein)
-