SLC2A4 Antikörper (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 4)

Details for Product anti-SLC2A4 Antibody No. ABIN635266
Antigen
Reaktivität
Human
136
102
75
12
11
10
5
3
3
3
2
1
1
Wirt
Kaninchen
110
44
7
1
Klonalität
Polyklonal
Konjugat
Dieser SLC2A4 Antikörper ist unkonjugiert
6
5
5
3
3
3
3
3
3
1
1
1
1
1
Applikation
Western Blotting (WB)
127
65
59
35
25
24
15
14
12
4
3
2
1
1
Optionen
Immunogen GLUT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV
Reinigung Affinity purified
Antigen
Andere Bezeichnung GLUT4 (SLC2A4 Antibody Abstract)
Hintergrund SLC2A4 is a member of the solute carrier family 2 (facilitated glucose transporter) family and functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus.
Molekulargewicht 55 kDa (MW of target protein)
Pathways AMPK Signaling, Carbohydrate Homeostasis, Proton Transport, Brown Fat Cell Differentiation
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GLUT4 Blocking Peptide, catalog no. 33R-5310, is also available for use as a blocking control in assays to test for specificity of this GLUT4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 4 (SLC2A4) antibody (ABIN635266) GLUT4 antibody used at 1 ug/ml to detect target protein.