RNF217 Antikörper (Middle Region)

Produktnummer ABIN635258

Produktdetails anti-RNF217 Antikörper

Target: RNF217 (Ring Finger Protein 217 (RNF217))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF217 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF217 antibody was raised against the middle region of RNF217

Aufreinigung: Affinity purified

Immunogen: RNF217 antibody was raised using the middle region of RNF217 corresponding to a region with amino acids GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF217 Blocking Peptide, catalog no. 33R-3383, is also available for use as a blocking control in assays to test for specificity of this RNF217 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF217 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF217

Target: RNF217 (Ring Finger Protein 217 (RNF217))

Andere Bezeichnung: RNF217 (RNF217 Produkte)

Synonyme: Ibrdc1 antikoerper, RNF217 antikoerper, IBRDC1 antikoerper, C6orf172 antikoerper, dJ84N20.1 antikoerper, AU016819 antikoerper, ring finger protein 217 antikoerper, ring finger protein 217 L homeolog antikoerper, Rnf217 antikoerper, RNF217 antikoerper, rnf217.L antikoerper

Hintergrund: RNF217 is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molekulargewicht: 32 kDa (MW of target protein)