TMEM57 Antikörper (Transmembrane Protein 57) (N-Term)

Details for Product anti-TMEM57 Antibody No. ABIN635187
Antigen
Epitop
N-Term
8
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund
21
13
3
3
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
22
Klonalität
Polyklonal
Konjugat
Dieser TMEM57 Antikörper ist unkonjugiert
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
17
9
9
1
Optionen
Immunogen TMEM57 antibody was raised using the N terminal of TMEM57 corresponding to a region with amino acids VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF
Spezifität TMEM57 antibody was raised against the N terminal of TMEM57
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM57
Hintergrund The function of TMEM57 protein has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 76 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM57 Blocking Peptide, catalog no. 33R-9906, is also available for use as a blocking control in assays to test for specificity of this TMEM57 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM57 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 57 (TMEM57) (N-Term) antibody (ABIN635187) TMEM57 antibody used at 1 ug/ml to detect target protein.