Chromosome 6 Open Reading Frame 192 (C6orf192) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635175
Antigen
Epitop
N-Term
15
1
1
Reaktivität
Human
19
16
16
2
2
1
1
1
1
Wirt
Kaninchen
19
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
6
4
1
Optionen
Immunogen C6 ORF192 antibody was raised using the N terminal Of C6 rf192 corresponding to a region with amino acids ISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLAS
Spezifität C6 ORF192 antibody was raised against the N terminal Of C6 rf192
Reinigung Affinity purified
Antigen
Andere Bezeichnung C6ORF192 (C6orf192 Antibody Abstract)
Hintergrund This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown.
Molekulargewicht 49 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C6ORF192 Blocking Peptide, catalog no. 33R-4143, is also available for use as a blocking control in assays to test for specificity of this C6ORF192 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF192 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Chromosome 6 Open Reading Frame 192 (C6orf192) (N-Term) antibody (ABIN635175) C6ORF192 antibody used at 1 ug/ml to detect target protein.