SPOCK3 Antikörper

Produktnummer ABIN635166

Produktdetails anti-SPOCK3 Antikörper

Target: SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPOCK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPOCK3 Blocking Peptide, catalog no. 33R-1758, is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPOCK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPOCK3

Target: SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))

Andere Bezeichnung: SPOCK3 (SPOCK3 Produkte)

Synonyme: im:7139568 antikoerper, si:dkey-285b22.1 antikoerper, HSAJ1454 antikoerper, TES-3 antikoerper, TICN3 antikoerper, Testican-3 antikoerper, 2900045C01Rik antikoerper, AI428471 antikoerper, mKIAA4039 antikoerper, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 antikoerper, SPARC/osteonectin, cwcv and kazal like domains proteoglycan 3 antikoerper, sparc/osteonectin, cwcv and kazal-like domains proteoglycan 3 antikoerper, spock3 antikoerper, SPOCK3 antikoerper, Spock3 antikoerper

Hintergrund: Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding family Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process