SV2A Antikörper (Middle Region)
-
- Target Alle SV2A Antikörper anzeigen
- SV2A (Synaptic Vesicle Glycoprotein 2A (SV2A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SV2A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SV2 A antibody was raised against the middle region of SV2
- Aufreinigung
- Affinity purified
- Immunogen
- SV2 A antibody was raised using the middle region of SV2 corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
- Top Product
- Discover our top product SV2A Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SV2A Blocking Peptide, catalog no. 33R-4916, is also available for use as a blocking control in assays to test for specificity of this SV2A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SV0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SV2A (Synaptic Vesicle Glycoprotein 2A (SV2A))
- Andere Bezeichnung
- SV2A (SV2A Produkte)
- Synonyme
- AI746429 antikoerper, mKIAA0736 antikoerper, Sv2 antikoerper, SV2 antikoerper, synaptic vesicle glycoprotein 2A antikoerper, synaptic vesicle glycoprotein 2 a antikoerper, synaptic vesicle glycoprotein 2a antikoerper, SV2A antikoerper, CpipJ_CPIJ017596 antikoerper, sv2a antikoerper, Sv2a antikoerper
- Hintergrund
- SV2A plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. It positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.
- Molekulargewicht
- 83 kDa (MW of target protein)
-