ATP6V0C Antikörper (Middle Region)

Produktnummer ABIN635137

Produktdetails anti-ATP6V0C Antikörper

Target: ATP6V0C (ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V0C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 antibody was raised against the middle region of ATP6 6

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 antibody was raised using the middle region of ATP6 6 corresponding to a region with amino acids VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V0C Blocking Peptide, catalog no. 33R-9868, is also available for use as a blocking control in assays to test for specificity of this ATP6V0C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V0C

Target: ATP6V0C (ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C))

Andere Bezeichnung: ATP6V0C (ATP6V0C Produkte)

Synonyme: ATP6C antikoerper, ATP6L antikoerper, ATPL antikoerper, VATL antikoerper, VPPC antikoerper, Vma3 antikoerper, Atp6c antikoerper, Atp6c2 antikoerper, Atp6l antikoerper, Atpl antikoerper, Atpl-rs1 antikoerper, PL16 antikoerper, CHUNP6904 antikoerper, atp6l antikoerper, atp6v0c antikoerper, cb993 antikoerper, fb57d09 antikoerper, wu:fb57d09 antikoerper, atp6c antikoerper, atpl antikoerper, ductin antikoerper, vatl antikoerper, vma3 antikoerper, PLP antikoerper, wu:fc74d11 antikoerper, zgc:111904 antikoerper, zgc:77708 antikoerper, ATPase H+ transporting V0 subunit c antikoerper, ATPase, H+ transporting, lysosomal V0 subunit C antikoerper, ATPase H+ transporting V0 subunit C antikoerper, ATPase, H+ transporting, lysosomal, V0 subunit ca antikoerper, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c antikoerper, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c L homeolog antikoerper, V-type proton ATPase 16 kDa proteolipid subunit antikoerper, ATPase, H+ transporting, lysosomal, V0 subunit cb antikoerper, ATP6V0C antikoerper, Atp6v0c antikoerper, atp6v0ca antikoerper, atp6v0c antikoerper, atp6v0c.L antikoerper, LOC696755 antikoerper, atp6v0cb antikoerper

Hintergrund: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport