SLC2A6 Antikörper (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 6)

Details for Product anti-SLC2A6 Antibody No. ABIN635124
Antigen
Reaktivität
Human
22
2
1
1
1
Wirt
Kaninchen
20
2
Klonalität
Polyklonal
Konjugat
Dieser SLC2A6 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
17
9
7
1
1
1
Optionen
Immunogen GLUT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV
Reinigung Affinity purified
Antigen
Andere Bezeichnung GLUT6 (SLC2A6 Antibody Abstract)
Hintergrund Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.
Molekulargewicht 54 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GLUT6 Blocking Peptide, catalog no. 33R-9532, is also available for use as a blocking control in assays to test for specificity of this GLUT6 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 6 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 6 (SLC2A6) antibody (ABIN635124) GLUT6 antibody used at 1 ug/ml to detect target protein.