OR11H12 Antikörper (N-Term)

Produktnummer ABIN635110

Produktdetails anti-OR11H12 Antikörper

Target: OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OR11H12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OR11 H12 antibody was raised against the N terminal of OR11 12

Aufreinigung: Affinity purified

Immunogen: OR11 H12 antibody was raised using the N terminal of OR11 12 corresponding to a region with amino acids CPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OR11H12 Blocking Peptide, catalog no. 33R-1768, is also available for use as a blocking control in assays to test for specificity of this OR11H12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OR11H12

Target: OR11H12 (Olfactory Receptor, Family 11, Subfamily H, Member 12 (OR11H12))

Andere Bezeichnung: OR11H12 (OR11H12 Produkte)

Synonyme: olfactory receptor family 11 subfamily H member 12 antikoerper, OR11H12 antikoerper

Hintergrund: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molekulargewicht: 36 kDa (MW of target protein)