SLC15A2 Antikörper
-
- Target Alle SLC15A2 Antikörper anzeigen
- SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC15A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC15 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV
- Top Product
- Discover our top product SLC15A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC15A2 Blocking Peptide, catalog no. 33R-3445, is also available for use as a blocking control in assays to test for specificity of this SLC15A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC15A2 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 2 (SLC15A2))
- Andere Bezeichnung
- SLC15A2 (SLC15A2 Produkte)
- Synonyme
- PEPT2 antikoerper, pept2 antikoerper, MGC64416 antikoerper, wu:fc84g07 antikoerper, wu:fi22a10 antikoerper, zgc:152684 antikoerper, OPT-3 antikoerper, 8430408C16Rik antikoerper, C78862 antikoerper, Pept2 antikoerper, solute carrier family 15 member 2 antikoerper, solute carrier family 15 member 2 L homeolog antikoerper, solute carrier family 15 (oligopeptide transporter), member 2 antikoerper, solute carrier family 15 (H+/peptide transporter), member 2 antikoerper, SLC15A2 antikoerper, slc15a2.L antikoerper, slc15a2 antikoerper, Slc15a2 antikoerper
- Hintergrund
- SLC15A2 belongs to the PTR2/POT transporter family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.
- Molekulargewicht
- 82 kDa (MW of target protein)
-