CYP4A22 Antikörper (N-Term)

Produktnummer ABIN635097

Produktdetails anti-CYP4A22 Antikörper

Target: CYP4A22 (Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4A22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CYP4 A22 antibody was raised against the N terminal of CYP4 22

Aufreinigung: Affinity purified

Immunogen: CYP4 A22 antibody was raised using the N terminal of CYP4 22 corresponding to a region with amino acids MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4A22 Blocking Peptide, catalog no. 33R-6526, is also available for use as a blocking control in assays to test for specificity of this CYP4A22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4A22

Target: CYP4A22 (Cytochrome P450, Family 4, Subfamily A, Polypeptide 22 (CYP4A22))

Andere Bezeichnung: CYP4A22 (CYP4A22 Produkte)

Synonyme: cytochrome P450 family 4 subfamily A member 22 antikoerper, cytochrome P450, family 4, subfamily A, polypeptide 22 antikoerper, CYP4A22 antikoerper

Hintergrund: CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Monocarboxylic Acid Catabolic Process