SLC25A20 Antikörper

Produktnummer ABIN635058

Produktdetails anti-SLC25A20 Antikörper

Target: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC25 A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A20 Blocking Peptide, catalog no. 33R-3287, is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A20

Target: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Andere Bezeichnung: SLC25A20 (SLC25A20 Produkte)

Synonyme: 5848 antikoerper, BG:DS02740.15 antikoerper, CACT antikoerper, CG5848 antikoerper, Cact antikoerper, Dmel\\CG5848 antikoerper, cac antikoerper, dip6 antikoerper, fs(2)ltoRN48 antikoerper, n(2)k17003 antikoerper, cact antikoerper, dif-1 antikoerper, SLC25A20 antikoerper, DKFZp468F1219 antikoerper, zgc:77760 antikoerper, PRKAR2A antikoerper, CAC antikoerper, 1110007P09Rik antikoerper, C78826 antikoerper, mCAC antikoerper, cactus antikoerper, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 antikoerper, solute carrier family 25 member 20 antikoerper, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 L homeolog antikoerper, solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 antikoerper, cact antikoerper, slc25a20 antikoerper, SLC25A20 antikoerper, Slc25a20 antikoerper, slc25a20.L antikoerper

Hintergrund: SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.It mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades